Items 1701 to 1720 of 2095 total

per page
Page:
  1. 84
  2. 85
  3. 86
  4. 87
  5. 88

Set Descending Direction
    Cat. No. Name CAS No. Description
    KI2003 SB-705498 501951-42-4 SB-705498 is a potent and selective vanilloid receptor-1 (VR1/TRPV1) antagonist....
    KI4240 SB1317 1204918-72-8 ....
    KI5953 SB271046 209481-20-9 ....
    KI2531 SB706375 733734-61-7 SB706375 is a potent, reversible and selective mammalian UT receptor antagonist....
    KI6528 SBC-115076 489415-96-5 ....
    KI6529 SBI0206965 1884220-36-3 ....
    KI6530 SC66 871361-88-5 ....
    KI6227 SC75741 913822-46-5 ....
    KI4750 SCH 23390 hydrochloride 125941-87-9 ....
    KI4896 SCH-1473759 1094069-99-4 ....
    KI2010 SCH-527123 473727-83-2 SCH-527123 is a novel antagonist of both CXCR1 and CXCR2 with IC50s of 36 and 2.6 nM, respectively....
    KI6531 SCH-58261 160098-96-4 ....
    KI5079 SCH619734 552292-08-7 ....
    KI4490 SCH79797 2HCl 245520-69-8 ....
    KI3985 SCH900776(R) 891495-88-8 ....
    KI7178 Scopolamine N-oxide hydrobromide 6106-81-6 ....
    KI5896 SCR7 1533426-72-0 ....
    KI5820 SD208 627536-09-8 ....
    KI9384 SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS ....
    KI4779 SEA0400 223104-29-8 ....

Items 1701 to 1720 of 2095 total

per page
Page:
  1. 84
  2. 85
  3. 86
  4. 87
  5. 88

Set Descending Direction