Items 1 to 20 of 530 total

per page
Page:
  1. 1
  2. 2
  3. 3
  4. 4
  5. 5

Set Descending Direction
    Cat. No. Name
    KP0101 α - Gliadin (31 - 43)
    LGQQQPFPPQQPY
    KP0108 α9 - Gliadin (57 - 68)
    QLQPFPQPQLPY
    KP0118 ω-Conotoxin GVIA
    CKS(Hyp)GSSCS(Hyp)TSYNCCRSCN(Hyp)YTKRCY-NH2
    KP0120 ω-Conotoxin MVIIA
    CKGKGAKCSRLMYDCCTGSCRSGKC-NH2 (Disulfide bridge: 1-16, 8-20, and 15-25)
    KP0122 ω-Conotoxin MVIIC
    CKGKGAPCRKTMYDCCSGSCGRRGKC-NH2 (Disulfide bridge: 1-16, 8-20,and 15-26)
    KP0006 (Z-AA)2Rh110[Rhodamine 110, bis-(CBZ-L-alanyl-L-alanine amide)]
    KP0007 (Z-Ala-Ala-Ala-Ala)2Rh110[Rhodamine 110, bis-(CBZ-L-alanyl-L-alanyl-L-alanyl-L- alanine amide)]
    KP0008 (Z-AR)2Rh110.HCl[Rhodamine 110, bis-(CBZ-L-alanyl-L-arginine amide)]
    KP0009 (Z-Arg)2Rh110.2HCl[Rhodamine 110, bis-(CBZ-L-arginine amide)]
    KP0010 (Z-Phe-Arg)2Rh110
    (Z-FR)2Rh110
    KP0124 2 CDC25C, CHK1 and CHK2 Substrate, phosphorylated
    KKKVSRSGLYR-pS-PSMPENLNRPR-NH2
    KP0127 2837b, Hemoglobin Fragment, Plasmepsin II (PM II) substrate, EDANS/ DABCYL
    EDANS-CO-CH2-CH2-CO-ALERMFLSFP-Dap(DABCYL)OH
    KP0128 2A/2B Dengue Protease Substrate
    Ac-RTSKKR-pNA
    KP0129 2B/3, Dengue Protease Substrate
    Ac-EVKKQR-pNA
    KP0130 3 x Hemagglutinin (HA) Tag
    MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE
    KP0150 3x DYKDDDDK Tag
    DYKDDDDKDYKDDDDKDYKDDDDK
    KP0164 5 - FAM - PMDM6 (PMDM6 - F)
    5-FAM-(β-A)-(β-A)-FM-Aib-pY-(6-Cl-DL-Trp)-E-Ac3c-LN-NH2
    KP0167 5 - TMR - GPHRSTPESRAAV
    5-TMR-GPHRSTPESRAAV
    KP0168 5 - TMR - RRADDSDDDDD
    5-TMR-RRADDSDDDDD
    KP0169 5 - TMR - RRKDLHDDEEDEAMSITA
    5-TMR-RRKDLHDDEEDEAMSITA

Items 1 to 20 of 530 total

per page
Page:
  1. 1
  2. 2
  3. 3
  4. 4
  5. 5

Set Descending Direction