| Cat. No. | Name | CAS No. | Description |
|---|---|---|---|
| KI2543 | VUF10460 | 1028327-66-3 | VUF10460 is a H4 receptor agonist.... |
| KI7274 | VU6005649 | 2137047-43-7 | .... |
| KI3754 | VU0361737 | 1161205-04-4 | VU 0361737 is a selective positive allosteric modulator (PAM) for mGlu4 receptor with EC50 of 240 nM and 110 nM at human and rat receptors respectively.... |
| KI4189 | VU 0357121 | 433967-28-3 | .... |
| KI4893 | VTP-27999 2,2,2-trifluoroacetate | 1013937-63-7 | .... |
| KI5754 | VTP-27999 | 942142-51-0 | .... |
| KI9493 | VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | .... | |
| KI5076 | VRT752271 HCL | 869886-67-9 | .... |
| KI5075 | VRT752271 | 869886-67-9 | .... |
| KI5889 | VRT-1353385 | 1616113-45-1 | .... |
| KI6587 | VR23 | 1624602-30-7 | .... |
| KI6586 | VPS34-IN1 | 1383716-33-3 | .... |
| KI9462 | Vps34-IN-2 | 1523404-29-6 | .... |
| KI4955 | Vortioxetine | 508233-74-7 | .... |
| KI9497 | Vorasidenib | 1644545-52-7 | .... |
| KI6585 | Vorapaxar sulfate | 705260-08-8 | .... |
| KI5890 | Vonoprazan | 881681-00-1 | .... |
| KI6798 | VLX1570 | 1431280-51-1 | .... |
| KI9363 | Vitamin K4 | 573-20-6 | .... |
| KI9374 | Vitamin CK3 | 1085703-32-7 | .... |