| Cat. No. | Name | CAS No. | Description |
|---|---|---|---|
| KI9497 | Vorasidenib | 1644545-52-7 | .... |
| KI4955 | Vortioxetine | 508233-74-7 | .... |
| KI9462 | Vps34-IN-2 | 1523404-29-6 | .... |
| KI6586 | VPS34-IN1 | 1383716-33-3 | .... |
| KI6587 | VR23 | 1624602-30-7 | .... |
| KI5889 | VRT-1353385 | 1616113-45-1 | .... |
| KI5075 | VRT752271 | 869886-67-9 | .... |
| KI5076 | VRT752271 HCL | 869886-67-9 | .... |
| KI9493 | VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | .... | |
| KI5754 | VTP-27999 | 942142-51-0 | .... |
| KI4893 | VTP-27999 2,2,2-trifluoroacetate | 1013937-63-7 | .... |
| KI4189 | VU 0357121 | 433967-28-3 | .... |
| KI3754 | VU0361737 | 1161205-04-4 | VU 0361737 is a selective positive allosteric modulator (PAM) for mGlu4 receptor with EC50 of 240 nM and 110 nM at human and rat receptors respectively.... |
| KI7274 | VU6005649 | 2137047-43-7 | .... |
| KI2543 | VUF10460 | 1028327-66-3 | VUF10460 is a H4 receptor agonist.... |
| KI4716 | VX-661 | 1152311-62-0 | .... |
| KI2753 | VX765 | 273404-37-8 | VX-765 is an orally-absorbed pro-drug of VRT-043198.... |
| KI7031 | W-2429 | 37795-69-0 | .... |
| KI4533 | Walrycin B | 878419-78-4 | .... |
| KI9346 | Warangalone | 4449-55-2 | .... |