Items 2021 to 2040 of 2095 total

per page
Page:
  1. 100
  2. 101
  3. 102
  4. 103
  5. 104

Set Descending Direction
    Cat. No. Name CAS No. Description
    KI9497 Vorasidenib 1644545-52-7 ....
    KI4955 Vortioxetine 508233-74-7 ....
    KI9462 Vps34-IN-2 1523404-29-6 ....
    KI6586 VPS34-IN1 1383716-33-3 ....
    KI6587 VR23 1624602-30-7 ....
    KI5889 VRT-1353385 1616113-45-1 ....
    KI5075 VRT752271 869886-67-9 ....
    KI5076 VRT752271 HCL 869886-67-9 ....
    KI9493 VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS ....
    KI5754 VTP-27999 942142-51-0 ....
    KI4893 VTP-27999 2,2,2-trifluoroacetate 1013937-63-7 ....
    KI4189 VU 0357121 433967-28-3 ....
    KI3754 VU0361737 1161205-04-4 VU 0361737 is a selective positive allosteric modulator (PAM) for mGlu4 receptor with EC50 of 240 nM and 110 nM at human and rat receptors respectively....
    KI7274 VU6005649 2137047-43-7 ....
    KI2543 VUF10460 1028327-66-3 VUF10460 is a H4 receptor agonist....
    KI4716 VX-661 1152311-62-0 ....
    KI2753 VX765 273404-37-8 VX-765 is an orally-absorbed pro-drug of VRT-043198....
    KI7031 W-2429 37795-69-0 ....
    KI4533 Walrycin B 878419-78-4 ....
    KI9346 Warangalone 4449-55-2 ....

Items 2021 to 2040 of 2095 total

per page
Page:
  1. 100
  2. 101
  3. 102
  4. 103
  5. 104

Set Descending Direction