Cat. No. Name Size Price Add Cart
KP0197 AGRP fragment (83 - 132), amide 1 mg $790

Product Information

Product NameAGRP fragment (83 - 132), amide
Purity% Peak Area By HPLC ≥ 95%
Molecular Weight 5687.7
Storage-20°C
Sequence
(One-Letter Code)
SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT-NH2 (5 disulfide bridges)
Sequence
(Three-Letter Code)
H - Ser - Ser - Arg - Arg - Cys - Val - Arg - Leu - His - Glu - Ser - Cys - Leu - Gly - Gln - Gln - Val - Pro - Cys - Cys - Asp - Pro - Cys - Ala - Thr - Cys - Tyr - Cys - Arg - Phe - Phe - Asn - Ala - Phe - Cys - Tyr - Cys - Arg - Lys - Leu - Gly - Thr - Ala - Met - Asn - Pro - Cys - Ser - Arg - Thr - NH2 (5 disulfide bridges; 87 - 102, 94 - 108, 101 - 119, 105 - 129 and 110 - 117).
DescriptionThis peptide is a known endogenous MC3R and MC4R antagonist and a powerful orexigenic peptide when infused centrally. It increases cortisol release and inhibits pulsatile LH release in monkey. AGRP, like NPY, may mediate the effect of a negative energy balance on the reproductive system by suppressing the GnRH pulse generator. AgRP (83-132) significantly increases prolactin mRNA expression level and prolactin accumulation.
ReferencesRef: Vulliemoz, NR. et al. Endocrinol. 146, 784 (2005); Langouche, L. et al. J. Neuroendocrinol. 16, 695 (2004); Yang, Y. et al. Mol. Endocrinol. 13, 148 (1999).
Please click here to fill online order form, and we will make sure to supply you product with detail information. This process usually takes between 24 to 48 hours, depending on products stock avaliability. All inquires and subsequent projects are handled in the strictest confidence and will be backed by a confidentiality agreement if required.
KareBayTM provides scientists and clinicians with a wide range of biotechnological products and science lab supplies for chemical research and analyzing life processes. KareBay's extensive capabilities include commercializing reagents and kits, manufacturing biotech products and providing contract research services to organizations worldwide. Our many global labs, offices, and business partners enable KareBay to extend its products and services to its customer base around the world.

Our products are used for research, laboratory and further evaluation purposes. They are not for human use.