Cat. No. Name Size Price Add Cart
KP0261 Antennapedia Bak BH3 (Ant - BH3) (71 - 89) Fusion peptide 1 mg $270

Product Information

Product NameAntennapedia Bak BH3 (Ant - BH3) (71 - 89) Fusion peptide
Purity% Peak Area By HPLC ≥ 95%
Molecular Weight 4404.3
Storage-20°C
Sequence
(One-Letter Code)
RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY
Sequence
(Three-Letter Code)
H - Arg - Gln - Ile - Lys - Ile - Trp - Phe - Gln - Asn - Arg - Arg - Met - Lys - Trp - Lys - Lys - Met - Gly - Gln - Val - Gly - Arg - Gln - Leu - Ala - Ile - Ile - Gly - Asp - Asp - Ile - Asn - Arg - Arg - Tyr - OH
DescriptionThis is a fusion peptide containing amino acids 71 to 89 fragment of the Bak BH3 domain fused to antennapedia peptide. The Bcl-2 homology 3 (BH3) domain is crucial for the death-inducing and dimerization properties of pro-apoptotic members of the Bcl-2 protein family, including Bak, Bax, and Bad. Synthetic peptides corresponding to the BH3 domain of Bak bind to Bcl-xL, antagonize its anti-apoptotic function, and rapidly induce apoptosis when delivered into intact cells via fusion to the antennapedia homeoprotein internalization domain.
ReferencesHolinger, E. et al. J. Biol. Chem. 274, 13298 (1999).
Please click here to fill online order form, and we will make sure to supply you product with detail information. This process usually takes between 24 to 48 hours, depending on products stock avaliability. All inquires and subsequent projects are handled in the strictest confidence and will be backed by a confidentiality agreement if required.
KareBayTM provides scientists and clinicians with a wide range of biotechnological products and science lab supplies for chemical research and analyzing life processes. KareBay's extensive capabilities include commercializing reagents and kits, manufacturing biotech products and providing contract research services to organizations worldwide. Our many global labs, offices, and business partners enable KareBay to extend its products and services to its customer base around the world.

Our products are used for research, laboratory and further evaluation purposes. They are not for human use.