Cat. No. Name Size Price Add Cart
KP0275 Apolipoprotein E (131 - 169) 1 mg $322

Product Information

Product NameApolipoprotein E (131 - 169)
Purity% Peak Area By HPLC ≥ 95%
Molecular Weight 4633.5
Storage-20°C
Sequence
(One-Letter Code)
GRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRD
Sequence
(Three-Letter Code)
H - Gly - Arg - Leu - Val - Gln - Tyr - Arg - Gly - Glu - Val - Gln - Ala - Met - Leu - Gly - Gln - Ser - Thr - Glu - Glu - Leu - Arg - Val - Arg - Leu - Ala - Ser - His - Leu - Arg - Lys - Leu - Arg - Lys - Arg - Leu - Leu - Arg - Asp - OH
DescriptionThis peptide is derived from apolipoprotein E (apoE) residues 131-169. ApoE is primarily synthesized by the liver but can also be found in the spleen, kidney, adrenals, gonads, and brain. It is a ligand for low-density lipoprotein receptors and is involved in cholesterol and lipid transport and metabolism. ApoE is associated with peripheral nerve injury and regeneration, immunoregulation, and regulation of cell growth and differentiation. It has also been implicated in the pathogenesis of Alzheimer's disease (AD), arteriosclerosis, and familial type III hyperlipoproteinemia.
ReferencesDavignon, J. et al. Arterioscler Thromb Vasc Biol 8, 1 (1988); Mahley, RW. Science 240, 622 (1988).
Please click here to fill online order form, and we will make sure to supply you product with detail information. This process usually takes between 24 to 48 hours, depending on products stock avaliability. All inquires and subsequent projects are handled in the strictest confidence and will be backed by a confidentiality agreement if required.
KareBayTM provides scientists and clinicians with a wide range of biotechnological products and science lab supplies for chemical research and analyzing life processes. KareBay's extensive capabilities include commercializing reagents and kits, manufacturing biotech products and providing contract research services to organizations worldwide. Our many global labs, offices, and business partners enable KareBay to extend its products and services to its customer base around the world.

Our products are used for research, laboratory and further evaluation purposes. They are not for human use.