Cat. No. Name Size Price Add Cart
KP0612 Chimeric Rabies Virus Glycoprotein Fragment (RVG - 9R) 1 mg $465

Product Information

Product NameChimeric Rabies Virus Glycoprotein Fragment (RVG - 9R)
Molecular Weight 4843.5
Storage-20°C
Sequence
(One-Letter Code)
YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
Sequence
(Three-Letter Code)
H - Tyr - Thr - Ile - Trp - Met - Pro - Glu - Asn - Pro - Arg - Pro - Gly - Thr - Pro - Cys - Asp - Ile - Phe - Thr - Asn - Ser - Arg - Gly - Lys - Arg - Ala - Ser - Asn - Gly - Gly - Gly - Gly - Arg - Arg - Arg - Arg - Arg - Arg - Arg - Arg - Arg - OH
DescriptionThis chimeric peptide is a fragment derived from rabies virus glycoprotein (RVG). Because neurotropic viruses cross the blood-brain barrier to infect brain cells, the same strategy may be used to enter the central nervous system and deliver siRNA to the brain. To enable siRNA binding, this chimeric peptide was synthesized by adding nonamer arginine residues at the carboxy terminus of RVG. This RVG-9R peptide was able to bind and transduce siRNA to neuronal cells in vitro, resulting in efficient gene silencing. After intravenous injection into mice, RVG-9R delivered siRNA to the neuronal cells, resulting in specific gene silencing within the brain. RVG-9R provides a safe and noninvasive approach for the delivery of siRNA and potentially other therapeutic molecules across the blood-brain barrier.
ReferencesKumar, P. et al. Nature 448, 39 (2007).
Please click here to fill online order form, and we will make sure to supply you product with detail information. This process usually takes between 24 to 48 hours, depending on products stock avaliability. All inquires and subsequent projects are handled in the strictest confidence and will be backed by a confidentiality agreement if required.
KareBayTM provides scientists and clinicians with a wide range of biotechnological products and science lab supplies for chemical research and analyzing life processes. KareBay's extensive capabilities include commercializing reagents and kits, manufacturing biotech products and providing contract research services to organizations worldwide. Our many global labs, offices, and business partners enable KareBay to extend its products and services to its customer base around the world.

Our products are used for research, laboratory and further evaluation purposes. They are not for human use.