Elafin - Elafin Supplier

Cat. No.	Name	Size	Price	Add Cart
KP0698	Elafin	1 mg	Quote

Product Information

Product Name	Elafin
Purity	% Peak Area By HPLC ≥ 95%
Molecular Weight	5999.3
Storage	-20°C
Sequence (One-Letter Code)	AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53)
Sequence (Three-Letter Code)	H - Ala - Gln - Glu - Pro - Val - Lys - Gly - Pro - Val - Ser - Thr - Lys - Pro - Gly - Ser - Cys - Pro - Ile - Ile - Leu - Ile - Arg - Cys - Ala - Met - Leu - Asn - Pro - Pro - Asn - Arg - Cys - Leu - Lys - Asp - Thr - Asp - Cys - Pro - Gly - Ile - Lys - Lys - Cys - Cys - Glu - Gly - Ser - Cys - Gly - Met - Ala - Cys - Phe - Val - Pro - Gln - OH (Disufide bonds between Cys16 - Cys45, Cys23 - Cys49, Cys32 - Cys44, Cys38 - Cys53)
Description	This is a fragment of the elafin (elastase-specific inhibitor), an antiproteinase and antimicrobial (gram-positive and gram-negative respiratory pathogens) molecule that is expressed at epithelial sites. Elafin is a potent inhibitor of HNE and proteinase 3 produced in the skin, and in the airways , which is up-regulated in response to early inflammatory cytokines such as TNF and IL-1. Elafin, along with SLPI, also shares characteristics with antimicrobial defensin-like molecules in being a low molecular weight cationic peptide with the ability to eliminate pulmonary pathogens.
References	King, A. et al. J. Clin. Endo. Metab. 88, 4426 (2003); Wiedow, O. et al . J. Biol. Chem. 265, 14791 (1990); Wiedow, O. et al. Biochem. Biophys. Res. Commun. 174, 6 (1991); Tremblay, G. et al. Am. J. Respir. Crit. Care Med. 154, 1092 (1996); Simpson, AJ. et al. J. Immunol. 167, 1778 (2001).

Please click here to fill online order form, and we will make sure to supply you product with detail information. This process usually takes between 24 to 48 hours, depending on products stock avaliability. All inquires and subsequent projects are handled in the strictest confidence and will be backed by a confidentiality agreement if required.

KareBay^TM provides scientists and clinicians with a wide range of biotechnological products and science lab supplies for chemical research and analyzing life processes. KareBay's extensive capabilities include commercializing reagents and kits, manufacturing biotech products and providing contract research services to organizations worldwide. Our many global labs, offices, and business partners enable KareBay to extend its products and services to its customer base around the world.

Our products are used for research, laboratory and further evaluation purposes. They are not for human use.

About

KareBay^TM Biochem
Sitemap
Blog

Custom Services

Organic Synthesis
Peptide Synthesis
Antibody Production
Protein Expression
Bioconjugation Service
Immunoassry Service
Molecular Biology Services
Oligonucleotides Synthesis
RNA Synthesis Service
cGMP Peptide Synthesis Services
cGMP Organic Synthesis Services

Biochemical Products

Small Molecule Inhibitors
Bioactive Compounds
Primary Antibodies
Peptides
Amino Acids
Reagents
Fluorescent dyes
Intermediates
PCR

KareBay^TM Biochem, Inc.
11 Deer Park Drive, Suite 102A
Monmouth Junction, NJ 08852

Telephone

: 732-823-1545

Fax

: 732-823-1349

product@karebaybio.com
service@karebaybio.com
support@karebaybio.com