Cat. No. Name Size Price Add Cart
KP1091 LL - 37 pentamide 1 mg $279

Product Information

Product NameLL - 37 pentamide
Purity% Peak Area By HPLC ≥ 95%
Molecular Weight 4522.4
Storage-20°C
Sequence
(One-Letter Code)
LLGNFFRKSKQKIGKQFKRIVQRIKNFFRNLVPRTQS
Sequence
(Three-Letter Code)
H - Leu - Leu - Gly - Asn - Phe - Phe - Arg - Lys - Ser - Lys - Gln - Lys - Ile - Gly - Lys - Gln - Phe - Lys - Arg - Ile - Val - Gln - Arg - Ile - Lys - Asn - Phe - Phe - Arg - Asn - Leu - Val - Pro - Arg - Thr - Gln - Ser - OH
DescriptionThis synthetic peptide is a modification of the LL-37 cathelicidin peptide in which each aspartic acid of LL-37 is replaced by an asparagine, and glutamic acid by glutamine. The anti-staphylococcal activity LL-37 pentamide is greater than that of LL-37 because multiple acidic residues of human LL-37 reduce its efficacy against Staphylococci.
ReferencesZhao, C. et al. Antimicrob. Agents Chemother. 45, 2695 (2001).
Please click here to fill online order form, and we will make sure to supply you product with detail information. This process usually takes between 24 to 48 hours, depending on products stock avaliability. All inquires and subsequent projects are handled in the strictest confidence and will be backed by a confidentiality agreement if required.
KareBayTM provides scientists and clinicians with a wide range of biotechnological products and science lab supplies for chemical research and analyzing life processes. KareBay's extensive capabilities include commercializing reagents and kits, manufacturing biotech products and providing contract research services to organizations worldwide. Our many global labs, offices, and business partners enable KareBay to extend its products and services to its customer base around the world.

Our products are used for research, laboratory and further evaluation purposes. They are not for human use.