Cat. No. Name Size Price Add Cart
KP1244 Neuromedin (B - 30) 5 mg $967

Product Information

Product NameNeuromedin (B - 30)
Purity% Peak Area By HPLC ≥ 95%
Molecular Weight 3485.1
Storage-20°C
Sequence
(One-Letter Code)
LSWDLPEPRSRAGKIRVHPRGNLWATGHFM-NH2
Sequence
(Three-Letter Code)
H - Leu - Ser - Trp - Asp - Leu - Pro - Glu - Pro - Arg - Ser - Arg - Ala - Gly - Lys - Ile - Arg - Val - His - Pro - Arg - Gly - Asn - Leu - Trp - Ala - Thr - Gly - His - Phe - Met - NH2
Please click here to fill online order form, and we will make sure to supply you product with detail information. This process usually takes between 24 to 48 hours, depending on products stock avaliability. All inquires and subsequent projects are handled in the strictest confidence and will be backed by a confidentiality agreement if required.
KareBayTM provides scientists and clinicians with a wide range of biotechnological products and science lab supplies for chemical research and analyzing life processes. KareBay's extensive capabilities include commercializing reagents and kits, manufacturing biotech products and providing contract research services to organizations worldwide. Our many global labs, offices, and business partners enable KareBay to extend its products and services to its customer base around the world.

Our products are used for research, laboratory and further evaluation purposes. They are not for human use.