Cat. No. Name Size Price Add Cart
KP1318 PACAP (1 - 27), amide, human, ovine, rat 1 mg $205

Product Information

Product NamePACAP (1 - 27), amide, human, ovine, rat
Purity% Peak Area By HPLC ≥ 95%
Molecular Weight 3147.7
Storage-20°C
Sequence
(One-Letter Code)
HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
Sequence
(Three-Letter Code)
H - His - Ser - Asp - Gly - Ile - Phe - Thr - Asp - Ser - Tyr - Ser - Arg - Tyr - Arg - Lys - Gln - Met - Ala - Val - Lys - Lys - Tyr - Leu - Ala - Ala - Val - Leu - NH2
DescriptionPACAP-27, the N-terminal fragment of PACAP-38, is a neuropeptide originally isolated from bovine hypothalamus, but is also found in humans and rats. It shows considerable homology with Vasoactive Intestinal Polypeptide (VIP), but stimulates adenylate cyclase much more potently than VIP. PACAP27 and PACAP38 stimulate cAMP accumulation and increase [Ca2+]i through the type I PACAP receptors.
ReferencesRef: Miyata, A. et al. BBRC 164, 567(1998); Chik, C. et al. J. Neurochem. 67, 1005 (1996).
Please click here to fill online order form, and we will make sure to supply you product with detail information. This process usually takes between 24 to 48 hours, depending on products stock avaliability. All inquires and subsequent projects are handled in the strictest confidence and will be backed by a confidentiality agreement if required.
KareBayTM provides scientists and clinicians with a wide range of biotechnological products and science lab supplies for chemical research and analyzing life processes. KareBay's extensive capabilities include commercializing reagents and kits, manufacturing biotech products and providing contract research services to organizations worldwide. Our many global labs, offices, and business partners enable KareBay to extend its products and services to its customer base around the world.

Our products are used for research, laboratory and further evaluation purposes. They are not for human use.