Cat. No. Name Size Price Add Cart
KP1339 PDKtide, biotin labeled 1 mg $370

Product Information

Product NamePDKtide, biotin labeled
Purity% Peak Area By HPLC ≥ 95%
Molecular Weight 5110.9
Storage-20°C
Sequence
(One-Letter Code)
Biotin-Ahx-KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC
Sequence
(Three-Letter Code)
Biotin-Ahx-Lys-Thr-Phe-Cys-Gly-Thr-Pro-Glu-Tyr-Leu-Ala-Pro-Glu-Val-Arg-Arg-Glu-Pro-Arg-Ile-Leu-Ser-Glu-Glu-Glu-Gln-Glu-Met-Phe-Arg-Asp-Phe-Asp-Tyr-Ile-Ala-Asp-Trp-Cys-OH
DescriptionThis 39-mer peptide is a biotinylated substrate for phosphatidylinositide-dependent kinase 1 (PDK1). Biotin is linked to the N-terminus of the peptide through an LC (6-carbon linker). PDK1 has a C-terminal pleckstrin homology domain that aims at phosphoinositide lipids on the plasma membrane. It is central to the activating protein kinase B, a protein that mediates biological responses to insulin and growth factors.
ReferencesBerggreen, C. et al. Am J Physiol Endocrinol Metab 296, 635 (2009); Scheid, M. et al. Mol Cell Biol 25, 6 (2005).
Please click here to fill online order form, and we will make sure to supply you product with detail information. This process usually takes between 24 to 48 hours, depending on products stock avaliability. All inquires and subsequent projects are handled in the strictest confidence and will be backed by a confidentiality agreement if required.
KareBayTM provides scientists and clinicians with a wide range of biotechnological products and science lab supplies for chemical research and analyzing life processes. KareBay's extensive capabilities include commercializing reagents and kits, manufacturing biotech products and providing contract research services to organizations worldwide. Our many global labs, offices, and business partners enable KareBay to extend its products and services to its customer base around the world.

Our products are used for research, laboratory and further evaluation purposes. They are not for human use.