Cat. No. Name Size Price Add Cart
KP1510 Secretoneurin 1 mg $275

Product Information

Product NameSecretoneurin
Purity% Peak Area By HPLC ≥ 95%
Molecular Weight 3652
Storage-20°C
Sequence
(One-Letter Code)
TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ
Sequence
(Three-Letter Code)
H - Thr - Asn - Glu - Ile - Val - Glu - Glu - Gln - Tyr - Thr - Pro - Gln - Ser - Leu - Ala - Thr - Leu - Glu - Ser - Val - Phe - Gln - Glu - Leu - Gly - Lys - Leu - Thr - Gly - Pro - Ser - Asn - Gln - OH
DescriptionThis peptide is amino acids 154 to 186 fragment of secretogranin II, designated secretoneurin. Secretoneurin is a neuropeptide generated in brain, adrenal medulla and other endocrine tissues by proteolytic processing of secretogranin II. Secretoneurin acts as direct angiogenic cytokine, inhibits endothelial cell (EC) apoptosis, stimulates EC proliferation, and activates the mitogen-activated protein kinase (MAPK) system and the Akt pathway.
ReferencesKirchmair R, et al. Neurosci. 53, 359 (1993); Kirchmair R, et al. Circulation 110, 1121 (2004); Fälth, M. et al. Mol. Cell. Proteom. 5, 998 (2006).
Please click here to fill online order form, and we will make sure to supply you product with detail information. This process usually takes between 24 to 48 hours, depending on products stock avaliability. All inquires and subsequent projects are handled in the strictest confidence and will be backed by a confidentiality agreement if required.
KareBayTM provides scientists and clinicians with a wide range of biotechnological products and science lab supplies for chemical research and analyzing life processes. KareBay's extensive capabilities include commercializing reagents and kits, manufacturing biotech products and providing contract research services to organizations worldwide. Our many global labs, offices, and business partners enable KareBay to extend its products and services to its customer base around the world.

Our products are used for research, laboratory and further evaluation purposes. They are not for human use.