Cat. No. Name Size Price Add Cart
KP1600 Tau Peptide (337-368) (Repeat 4 domain) 1 mg $75

Product Information

Product NameTau Peptide (337-368) (Repeat 4 domain)
PurityPeak Area by HPLC ≥95%
Molecular Weight 3467.86
Storage-20°C
Sequence
(One-Letter Code)
VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN
Sequence
(Three-Letter Code)
Val-Glu-Val-Lys-Ser-Glu-Lys-Leu-Asp-Phe-Lys-Asp-Arg-Val-Gln-Ser-Lys-Ile-Gly-Ser-Leu-Asp-Asn-Ile-Thr-His-Val-Pro-Gly-Gly-Gly-Asn-OH
DescriptionTAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer′s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus (see figure below). Tau Peptide (337-368) is a 32-amino acid long peptide derived from the Repeat 4 domain.RELATED PRODUCTS:Tau Peptide (45-73) (Exon 2/Insert 1 domain) Tau Peptide (74-102) (Exon 3/Insert 2 domain) Tau Peptide (244-274) (Repeat 1 domain)Tau Peptide (275-305) (Repeat 2 domain)Tau Peptide (306-336) (Repeat 3 domain)
ReferencesBuee, L. et al. Brain Res Rev 33 95 (2000).Trinczek, B. et al. Mol Biol Cell 6, 1887 (1995).
Please click here to fill online order form, and we will make sure to supply you product with detail information. This process usually takes between 24 to 48 hours, depending on products stock avaliability. All inquires and subsequent projects are handled in the strictest confidence and will be backed by a confidentiality agreement if required.
KareBayTM provides scientists and clinicians with a wide range of biotechnological products and science lab supplies for chemical research and analyzing life processes. KareBay's extensive capabilities include commercializing reagents and kits, manufacturing biotech products and providing contract research services to organizations worldwide. Our many global labs, offices, and business partners enable KareBay to extend its products and services to its customer base around the world.

Our products are used for research, laboratory and further evaluation purposes. They are not for human use.