Cat. No. Name Size Price Add Cart
KP1703 Ubiquitin (1 - 34) 1 mg $285

Product Information

Product NameUbiquitin (1 - 34)
Purity% Peak Area By HPLC ≥ 95%
Molecular Weight 3848.5
Storage-20°C
Sequence
(One-Letter Code)
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE
Sequence
(Three-Letter Code)
H - Met - Gln - Ile - Phe - Val - Lys - Thr - Leu - Thr - Gly - Lys - Thr - Ile - Thr - Leu - Glu - Val - Glu - Pro - Ser - Asp - Thr - Ile - Glu - Asn - Val - Lys - Ala - Lys - Ile - Gln - Asp - Lys - Glu - OH
DescriptionThis peptide is amino acids 1 to 34 fragment of ubiquitin. The main function of ubiquitin is labeling proteins for proteasomal degradation. Ubiquitin, a 76-residue protein, is shown to have activity against fungal and bacterial pathogens. This N-terminal peptide is stopped at the fungal wall level, whereas C-terminal peptide (residues 65-76) is able to cross the cell wall and the plasma membrane of fungi and to accumulate in fungi. It was shown that these two peptides act synergistically to kill filamentous fungi. This N-terminal peptide could be used with C-terminal-derived peptide as a potent anti-fungal agent.
ReferencesKieffer, A. et al. FASEB J. 10.1096/fj.02-0699fje (2003); Ozkaynak, E. et al. Nature 312, 663 (1984).
Please click here to fill online order form, and we will make sure to supply you product with detail information. This process usually takes between 24 to 48 hours, depending on products stock avaliability. All inquires and subsequent projects are handled in the strictest confidence and will be backed by a confidentiality agreement if required.
KareBayTM provides scientists and clinicians with a wide range of biotechnological products and science lab supplies for chemical research and analyzing life processes. KareBay's extensive capabilities include commercializing reagents and kits, manufacturing biotech products and providing contract research services to organizations worldwide. Our many global labs, offices, and business partners enable KareBay to extend its products and services to its customer base around the world.

Our products are used for research, laboratory and further evaluation purposes. They are not for human use.